Hexafluorosilicic acid

Hexafluorosilicic acid Basic information
Product Name:Hexafluorosilicic acid
Synonyms:SILICOFLUORIC ACID;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN;HYDROGEN HEXAFLUOROSILICATE;HYDROFLUOROSILICIC ACID;HYDROFLUOSILICIC ACID;HYDROSILICOFLUORIC ACID
CAS:16961-83-4
MF:F6H2Si
MW:144.09
EINECS:241-034-8
Product Categories:Fluoride;peptide;Inorganics;Acids;Electronic Chemicals;Micro/Nanoelectronics
Mol File:16961-83-4.mol
Hexafluorosilicic acid Structure
Hexafluorosilicic acid Chemical Properties
Boiling point 108-109°C
density 1.22 g/mL at 20 °C (lit.) 1.31 g/mL at 25 °C
vapor pressure 23hPa at 19.85℃
refractive index 1.3500
Fp 108-109°C
storage temp. −20°C
solubility H2O: 1 mg/mL, clear, colorless
pka1.83[at 20 ℃]
form Liquid
color Clear colorless
Specific Gravity1.38 (40%)
Water Solubility Miscible with water.
Hydrolytic Sensitivity0: forms stable aqueous solutions
Merck 14,4182
Exposure limitsACGIH: TWA 2.5 mg/m3
NIOSH: IDLH 250 mg/m3; TWA 2.5 mg/m3
Stability:Stable in aqueous solution.
InChIKeyAUJBMDCSBIPDEH-UHFFFAOYSA-N
CAS DataBase Reference16961-83-4(CAS DataBase Reference)
EPA Substance Registry SystemFluosilicic acid (16961-83-4)
Safety Information
Hazard Codes C
Risk Statements 34-35-20/21/22
Safety Statements 26-36/37/39-45-27
RIDADR UN 1778 8/PG 2
WGK Germany 3
RTECS VV8225000
8-10
Hazard Note Corrosive
TSCA Yes
HazardClass 8
PackingGroup II
HS Code 28111990
Hazardous Substances Data16961-83-4(Hazardous Substances Data)
ToxicityLD50 oral in rat: 430mg/kg
MSDS Information
ProviderLanguage
SigmaAldrich English
ACROS English
ALFA English
Hexafluorosilicic acid Usage And Synthesis
DescriptionHexafluorosilicic acid is a kind of inorganic acid. It is majorly used for the fluoridation of water in United State to minimize the incidence of dental caries and dental fluorosis. For chemical synthesis, it is majorly used for the manufacturing of aluminum fluoride and cryolite as well as many kinds of hexafluorosilicate salts. It can also be used for the production of silicon and silicon dioxide. It can also be used as an electrolyte in the Betts electrolytic process for refining lead. It is also a specialized reagent in organic synthesis for cleaving Si–O bonds of silyl ethers.
Chemical PropertiesFluosilicic acid,H2SiF6, also known as hydrofluorosilicic acid,is a colorless liquid that is soluble in water. It is highly corrosive and toxic,attacking glass and stoneware. Fluosilicic acid is used in water fluoridation, electroplating, and in manufacturing enamels and cement.
Chemical PropertiesFluorosilicic acid is a transparent, colorless fuming liquid.
Physical propertiesd 1.220 g cm?3 for a 25% aq solution.
UsesA fluoride source with both protic and Lewis acid properties providing efficient cleavage of silicon–oxygen bonds, e.g. silyl ether deprotection.
UsesHexafluorosilicic acid is commonly used as a source of fluoride. It is converted to a variety of useful hexafluorosilicate salts. It is also used as an electrolyte in the Betts electrolytic process for refining lead. It is an important organic reagent for cleaving Si-O bonds of silyl ethers. Further, it is used as wood a preservation agent and also used in surface modification of calcium carbonate.
UsesA 1-2% solution is used widely for sterilizing equipment in brewing and bottling establishments. Other concentrations are used in the electrolytic refining of lead, in electroplating, for hardening cement, crumbling lime or brick work, for the removal of lime from hides during the tanning process, to remove molds, as preservative for timber.
General DescriptionA colorless fuming liquid with a penetrating pungent odor. Corrosive to metals and tissue. Both the fumes and very short contact with the liquid can cause severe and painful burns. Used in water fluoridation, in hardening cement and ceramics, as a wood preservative.
Air & Water ReactionsFumes in air. Soluble in water with release of heat and corrosive fumes.
Reactivity ProfileHexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. Attacks glass and materials containing silica. Reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). Reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. Can initiate polymerization in certain alkenes. Reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. Flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. Additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give H2S and SO3), dithionites (SO2), and carbonates. Can catalyze (increase the rate of) chemical reactions. Decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.
HazardExtremely corrosive by skin contact and inhalation.
Health HazardInhalation of vapor produces severe corrosive effect on mucous membrane. Ingestion causes severe burns of mouth and stomach. Contact with liquid or vapor causes severe burns of eyes and skin.
Fire HazardSpecial Hazards of Combustion Products: Irritating fumes of hydrogen fluoride may form in fire.
Flammability and ExplosibilityNotclassified
Industrial usesHydrofluorosilicic acid (H2SiF6) is a colorless to light brown liquid. It is also manufactured from calcium fluoride or other fluoride-containing products. Hydrofluorosilic acid is a strong depressant for many silicates during flotation of a number of oxidic minerals. It is used for gangue depression during flotation of tin, columbite and tantalite.
Safety ProfilePoison by subcutaneous route. A corrosive irritant to sktn, eyes, and mucous membranes. Will react with water or steam to produce toxic and corrosive fumes. When heated to decomposition it emits toxic fumes of F-. See also FLUORIDES.
Potential ExposureA solution of fluorosilicic acid is used for sterilization in the brewing and bottling industry, elec trolytic refining of lead; electroplating, hardening cement; removing mold, and others.
ShippingUN1778 Fluorosilicic acid, Hazard class: 8; Labels: 8-Corrosive material.
IncompatibilitiesThe aqueous solution is a strong acid. Reacts with water or steam to produce toxic and corrosive fumes of hydrogen fluoride. Incompatible, and may react violently with: bases, aliphatic amines; alkanolamines, alkylene oxides; aromatic amines; amides, ammonia, ammonium hydroxide; calcium oxide; epichlorohydrin, iso cyanates, oleum, organic anhydrides; sulfuric acid; strong oxidizers; vinyl acetate; water. Attacks glass, concrete, and ceramics. The anhydrous form dissociates almost instantly into silicon tetrafluoride and hydrogen fluoride.
Waste DisposalAdd slowly to a large amount of soda ash in solution. Discharge to sewer with large volumes of water
ReferencesRobinson, Tim. "Innovative Processes in Electrometallurgy." Innovative Process Development in Metallurgical Industry. Springer International Publishing, 2016. 385- 392.
Sarawade, Pradip B., et al. "Recovery of high surface area mesoporous silica from waste hexafluorosilicic acid (H 2 SiF 6) of fertilizer industry." Journal of hazardous materials 173.1 (2010): 576-580.
Kauffman, Joel M. "Water fluoridation: a review of recent research and actions." Journal of American Physicians and Surgeons 10.2 (2005): 38.
Krot, V. V., et al. "ChemInform Abstract: Preparation of Amorphous Silicon Dioxide from Hexafluorosilicic Acid." Cheminform 23.48(1992):no-no.
Zorya, L., and V. Krot. "Method of high-purity silica production from hexafluorosilicic acid." Reaction Kinetics & Catalysis Letters 50.1-2(1993):349-354.



SILVER HEXAFLUOROSILICATE Barium hexafluorosilicate Ethyl 2-(Chlorosulfonyl)acetate LEAD SILICOFLUORIDE Silicone elastomer Ⅲ Hexafluorosilicic acid Stearic acid Folic acid COBALT SILICOFLUORIDE Potassium fluorosilicate Magnesium fluosilicate ALUMINUM FLUOROSILICATE Sodium fluorosilicate FERROUS SILICOFLUORIDE Cryptohalite ((NH4)2(SiF6)) ZINC SILICOFLUORIDE Calcium hexafluorosilicate Citric acid

Email:[email protected] [email protected]
Copyright © 2024 Mywellwork.com All rights reserved.